Engineering Papers⌕ Search

SEARCH · Engineering Papers

Results for “Spring”

Search indexed NASA NTRS and DOE OSTI research on propulsion, heat transfer, battery materials and energy systems. Follow report and document links to the original sources.

Quote a phrase for an exact phrase match. Source license links do not imply unrestricted reuse.

At least 775 records · Page 43
All sourcesNASA NTRSDOE OSTI
DOE OSTI2018

DASH Slow Strain Rates from Brady Hot Springs Geothermal Field during PoroTomo Deployment Period

This submission contains slow strain rates summed to radians over 30 second intervals [rad/s] derived from horizontal distributed acoustic sensing measurements (DASH) of Brady geothermal field during PoroTomo deployment (2016-Mar-14 to 2016-Mar-26). There is one file corresponding to each day written in *.mat format for use with Matlab. The format for the binary Matlab .mat files are defined at: https://www.mathworks.com/help/pdf_doc/matlab/matfile_format.pdf. One such file includes the following variables: 'flist': list of raw DASH files used in the summation 'time_tag_mdt': sample time tag in datetime format with hours given in 24-hr format (yyyy/MM/dd HH:mm:ss.SSSSSSS) 'time_tag_uts': sample time tag in Unix time 'strain_rate_summed_over30s_in_radians_per_second': slow strain rates summed over 30 second intervals in units rad/s 'sample_standard_deviation_in_radians_per_second': corresponding sample standard deviation of slow strain rates in units rad/s The PoroTomo final technical report, raw DASH data, and software repository are also available through the links below.

15 GEOTHERMAL ENERGY↗
NASA NTRS1966

Compression-spring separation mechanisms

Theseparationofspacecraftcomponents,whichoccurineveryflight,representscrucialandmajoreventsthatmustbesuccessfullyexecutedtofulfillmissionrequirements.Separationsystemsvaryaswidelyinphysicalandfunctionalpropertiesastheperformancerequirementswhichtheymustsatisfy;however,mostsystemsusehelicalcompressionspringsasanenergysource.Thispapersummarizestheprincipaldesigncharacteristicsofseparationmechanismsandempiricaldataobtainedfromactualseparationsinspace.

SEPARATION↗
NASA NTRS1997

NSCAT Observation of Spring Thaw in Alaskan Boreal Forest

The focus of this effort is the assessment of spaceborne scatteromter observations for monitoring landscape freeze/thaw transitions in the boreal forest thereby providing a means for estimating growing season duration.

Spring thaw Alaskan boreal forest NSCAT temperatur↗
NASA NTRS2018

Aqua Spring 2018 IAM Series Results

Each Inclination Adjust Maneuver (IAM) series requires a post-series analysis along with a long term prediction. This presentation analyzes Aqua's 2018 IAM series, some of the issues encountered, along with the long-term impact of this series performance. The long-term prediction covers Aqua's ground track and inclination progression until the next IAM series in 2019.

Aqua↗
NASA NTRS2019

Aqua Spring 2019 IAM Series Results

Each Inclination Adjust Maneuver (IAM) series requires a post-series analysis along with a long term prediction. This presentation analyzes Aqua's 2019 IAM series, some of the issues encountered, along with the long-term impact of this series performance. The long-term prediction covers Aqua's ground track and inclination progression until the next IAM series in 2020.

Aqua↗
NASA NTRSDate not supplied

Extreme Precipitation in the Southern US Great Plains in the Spring of 2015: Mechanisms and Prediction

During May of 2015, the southern US Great Plains and adjacent Gulf Coast region experienced more than twice the long-term mean precipitation, making it the wettest May since 1895. We investigate the physical mechanisms associated with this event using a suite of large-ensemble regional replay AGCM simulations from the NASA-GEOS model. In these simulations, certain regions of the globe are constrained to closely follow observations while the remainder of the domain is free running, allowing for the isolation of the remote regions that were important for the event. Preliminary analysis provides evidence that the extreme southern US precipitation was linked in part to positive precipitation anomalies in the central and eastern tropical Pacific via a wave train, which ultimately caused anomalous moisture flux from the Gulf of Mexico. An analysis of Subseasonal Experiment (SubX) model output was conducted to explore the subseasonal prediction skill of the event. Several models are able the predict the presence of positive precipitation anomalies in or near the southern US at lead times exceeding 10 days, albeit with errors in the locations and magnitude of the heaviest precipitation anomalies. A more thorough investigation with version 2 of NASA’s GEOS-S2S model shows that the prediction skill stems from the model’s ability to reasonably predict the positive tropical Pacific precipitation anomalies and the initiation of the Rossby wave train that is believed to be linked to the event. The potential causes for limitations in the prediction skill of this event will be explored.

Great Plains↗
DOE OSTI2019

Wind R&D Newsletter, Spring 2019

Biannual U.S. Department of Energy (DOE) Wind Research and Development (R&D) Newsletter providing recent news about the DOE Wind Energy Technologies Office's R&D projects, accomplishments, upcoming events, and recent publications.

wind, R&D, spring, projects, accomplishments, even↗
DOE OSTI2018

Wind R&D Newsletter, Spring 2018

Biannual U.S. Department of Energy (DOE) Wind Research and Development (R&D) Newsletter providing recent news about the DOE Wind Energy Technologies Office's R&D projects, accomplishments, upcoming events, and recent publications.

wind, R&D, spring, projects, accomplishments, even↗